RCAN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2124964
Artikelname: RCAN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2124964
Hersteller Artikelnummer: orb2124964
Alternativnummer: BYT-ORB2124964-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCAN3
Konjugation: Biotin
Alternative Synonym: RCN3, MCIP3, hRCN3, DSCR1L2
RCAN3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 038469
UniProt: Q9UKA8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA