ADAT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125009
Artikelname: ADAT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125009
Hersteller Artikelnummer: orb2125009
Alternativnummer: BYT-ORB2125009-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ADAT1
Konjugation: Biotin
Alternative Synonym: HADAT1
ADAT1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 95626
UniProt: Q9NVB7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF