CPSF6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125042
Artikelname: CPSF6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125042
Hersteller Artikelnummer: orb2125042
Alternativnummer: BYT-ORB2125042-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPSF6
Konjugation: Biotin
Alternative Synonym: CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
CPSF6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 008938
UniProt: Q16630
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP