APOBEC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125069
Artikelname: APOBEC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125069
Hersteller Artikelnummer: orb2125069
Alternativnummer: BYT-ORB2125069-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC2
Konjugation: Biotin
Alternative Synonym: ARP1, ARCD1
APOBEC2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 006780
UniProt: Q9Y235
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN