Igf2bp3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2125111
| Artikelname: |
Igf2bp3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2125111 |
| Hersteller Artikelnummer: |
orb2125111 |
| Alternativnummer: |
BYT-ORB2125111-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
IM, IMP3, Koc1, IMP-3, Koc13, mimp3, Neilsen, AA522010, AL022933, AU045931, 2610101N11Rik |
| Igf2bp3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
63kDa |
| NCBI: |
076159 |
| UniProt: |
Q9CPN8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI |
