NOL5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125147
Artikelname: NOL5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125147
Hersteller Artikelnummer: orb2125147
Alternativnummer: BYT-ORB2125147-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOL5A
Konjugation: Biotin
Alternative Synonym: NOL5A, SCA36
NOL5A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 18421
UniProt: A0PJ92
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK