ERAL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125258
Artikelname: ERAL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125258
Hersteller Artikelnummer: orb2125258
Alternativnummer: BYT-ORB2125258-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERAL1
Konjugation: Biotin
Alternative Synonym: ERA, CEGA, ERA-W, H-ERA, ERAL1A, ERAL1B, HERA-A, HERA-B, PRLTS6
ERAL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 005693
UniProt: O75616
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS