SCYE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125363
Artikelname: SCYE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125363
Hersteller Artikelnummer: orb2125363
Alternativnummer: BYT-ORB2125363-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCYE1
Konjugation: Biotin
Alternative Synonym: p43, HLD3, EMAP2, SCYE1, EMAPII
SCYE1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 004748
UniProt: Q12904
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF