ILF3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2125423
| Artikelname: |
ILF3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2125423 |
| Hersteller Artikelnummer: |
orb2125423 |
| Alternativnummer: |
BYT-ORB2125423-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90 |
| ILF3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
76kDa |
| NCBI: |
004507 |
| UniProt: |
Q12906 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD |