PABPC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125690
Artikelname: PABPC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125690
Hersteller Artikelnummer: orb2125690
Alternativnummer: BYT-ORB2125690-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PABPC1
Konjugation: Biotin
Alternative Synonym: PAB1, PABP, PABP1, PABPC2, PABPL1
PABPC1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 002559
UniProt: P11940
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ