EIF4E Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125747
Artikelname: EIF4E Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125747
Hersteller Artikelnummer: orb2125747
Alternativnummer: BYT-ORB2125747-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EIF4E
Konjugation: Biotin
Alternative Synonym: CBP, EIF4F, AUTS19, EIF4E1, eIF-4E, EIF4EL1
EIF4E Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 001959
UniProt: P06730
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV