PUM3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2125840
| Artikelname: |
PUM3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2125840 |
| Hersteller Artikelnummer: |
orb2125840 |
| Alternativnummer: |
BYT-ORB2125840-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0020 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
PEN, HA-8, PUF6, XTP5, PUF-A, HLA-HA8, KIAA0020 |
| PUM3 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
71kDa |
| NCBI: |
001026861 |
| UniProt: |
Q15397 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW |
