SERBP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125879
Artikelname: SERBP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125879
Hersteller Artikelnummer: orb2125879
Alternativnummer: BYT-ORB2125879-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERBP1
Konjugation: Biotin
Alternative Synonym: CGI-55, CHD3IP, HABP4L, PAIRBP1, PAI-RBP1
SERBP1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 001018077
UniProt: Q8NC51
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE