ASCL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127460
Artikelname: ASCL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127460
Hersteller Artikelnummer: orb2127460
Alternativnummer: BYT-ORB2127460-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ASCL3
Konjugation: Biotin
Alternative Synonym: SGN1, HASH3, bHLHa42
ASCL3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 065697
UniProt: Q9NQ33
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT