PRDM8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127487
Artikelname: PRDM8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127487
Hersteller Artikelnummer: orb2127487
Alternativnummer: BYT-ORB2127487-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM8
Konjugation: Biotin
Alternative Synonym: PFM5, EPM10, KMT8D
PRDM8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 064611
UniProt: Q9NQV8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHLSRHMTSH