ZNF313 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127550
Artikelname: ZNF313 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127550
Hersteller Artikelnummer: orb2127550
Alternativnummer: BYT-ORB2127550-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF313
Konjugation: Biotin
Alternative Synonym: ZNF313, PSORS12
ZNF313 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 061153
UniProt: Q9Y508
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYDVDEEDMMNQV