ZFP64 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127613
Artikelname: ZFP64 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127613
Hersteller Artikelnummer: orb2127613
Alternativnummer: BYT-ORB2127613-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP64
Konjugation: Biotin
Alternative Synonym: ZNF338
ZFP64 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 071371
UniProt: Q9NPA5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK