ZNF446 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127637
Artikelname: ZNF446 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127637
Hersteller Artikelnummer: orb2127637
Alternativnummer: BYT-ORB2127637-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF446
Konjugation: Biotin
Alternative Synonym: ZSCAN30, ZSCAN52, ZKSCAN20
ZNF446 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 060378
UniProt: Q9NWS9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQEVAGPREALARLREL