ZNF280D Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127661
Artikelname: ZNF280D Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127661
Hersteller Artikelnummer: orb2127661
Alternativnummer: BYT-ORB2127661-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF280D
Konjugation: Biotin
Alternative Synonym: SUHW4, ZNF634
ZNF280D Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
UniProt: Q6N043
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAIS