SIX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2127697
Artikelname: SIX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2127697
Hersteller Artikelnummer: orb2127697
Alternativnummer: BYT-ORB2127697-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIX4
Konjugation: Biotin
Alternative Synonym: AREC3
SIX4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 059116
UniProt: Q9UIU6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAVGLSPPAPAP