MECP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2128897
Artikelname: MECP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2128897
Hersteller Artikelnummer: orb2128897
Alternativnummer: BYT-ORB2128897-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MECP2
Konjugation: Biotin
Alternative Synonym: RS, RTS, RTT, PPMX, MRX16, MRX79, MRXSL, AUTSX3, MRXS13
MECP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 004983
UniProt: P51608
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPV