Foxk1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2128984
Artikelname: Foxk1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2128984
Hersteller Artikelnummer: orb2128984
Alternativnummer: BYT-ORB2128984-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Foxk1
Konjugation: Biotin
Alternative Synonym: RGD1309643
Foxk1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 001032296
UniProt: D3ZU55
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PVPSTAATATATAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVT