NFKB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2129095
| Artikelname: |
NFKB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2129095 |
| Hersteller Artikelnummer: |
orb2129095 |
| Alternativnummer: |
BYT-ORB2129095-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human NFKB1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta |
| NFKB1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
105kDa |
| NCBI: |
003989 |
| UniProt: |
P19838 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV |