BARX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2129164
Artikelname: BARX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2129164
Hersteller Artikelnummer: orb2129164
Alternativnummer: BYT-ORB2129164-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BARX2
Konjugation: Biotin
Alternative Synonym: MGC133368, MGC133369
BARX2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 003649
UniProt: Q9UMQ3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSL