ZNF205 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2129188
Artikelname: ZNF205 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2129188
Hersteller Artikelnummer: orb2129188
Alternativnummer: BYT-ORB2129188-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF205
Konjugation: Biotin
Alternative Synonym: RhitH, Zfp13, ZNF210
ZNF205 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 003447
UniProt: O95201
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPA