TCFL5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2130315
Artikelname: TCFL5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2130315
Hersteller Artikelnummer: orb2130315
Alternativnummer: BYT-ORB2130315-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse TCFL5
Konjugation: HRP
Alternative Synonym: CHA, Figlb, SOSF1, E2BP-1, bHLHe82
TCFL5 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 006593
UniProt: Q9UL49
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EKTPGGADGTRTRADGVAKEGAGGAGPDGAPEARAKPTVRVRLEDRFNSM