Tmem130 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2130318
Artikelname: Tmem130 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2130318
Hersteller Artikelnummer: orb2130318
Alternativnummer: BYT-ORB2130318-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: HRP
Alternative Synonym: BC067004, C130036G08
Tmem130 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 808403
UniProt: Q6NXM3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FTVKVRVVAEWEQIKPDTTKGTIQKTGDFSASLDLRESLQGIQILGPTLL