Tmem130 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2130322
Artikelname: Tmem130 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2130322
Hersteller Artikelnummer: orb2130322
Alternativnummer: BYT-ORB2130322-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: FITC
Alternative Synonym: BC067004, C130036G08
Tmem130 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 808403
UniProt: Q6NXM3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LVFLMYMTVRSAATQKDIVESPGATGLKCCCQVCCGSLFLDSPSEYLEIV