Mkx Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130323
Artikelname: Mkx Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130323
Hersteller Artikelnummer: orb2130323
Alternativnummer: BYT-ORB2130323-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mkx
Konjugation: Biotin
Alternative Synonym: Ir, Irxl1, 9430023B20Rik
Mkx Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 808263
UniProt: Q8BIA3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW