ZBTB38 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130343
| Artikelname: |
ZBTB38 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130343 |
| Hersteller Artikelnummer: |
orb2130343 |
| Alternativnummer: |
BYT-ORB2130343-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
FITC |
| Alternative Synonym: |
CIB, CIBZ, A930014K01Rik |
| ZBTB38 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
60kDa |
| NCBI: |
780746 |
| UniProt: |
Q8BIL1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS |
