A630025C20RIK Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2130391
Artikelname: A630025C20RIK Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2130391
Hersteller Artikelnummer: orb2130391
Alternativnummer: BYT-ORB2130391-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK
Konjugation: FITC
Alternative Synonym: Ml, Mlr2, Gm340, mKIAA1795, 3110023F06Rik, A630025C20Rik
A630025C20RIK Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 742166
UniProt: Q6ZPI3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK