A830039H10RIK Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2130393
Artikelname: A830039H10RIK Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2130393
Hersteller Artikelnummer: orb2130393
Alternativnummer: BYT-ORB2130393-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: HRP
Alternative Synonym: Ml, Mlr1
A830039H10RIK Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 742165
UniProt: Q8CJG4
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL