EBF4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130407
Artikelname: EBF4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130407
Hersteller Artikelnummer: orb2130407
Alternativnummer: BYT-ORB2130407-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EBF4
Konjugation: Biotin
Alternative Synonym: Ebf3, O/E-, O/E-4, Olf-1
EBF4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 694538
UniProt: Q8K4J2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNGLRTEQ