EBF4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130409
| Artikelname: |
EBF4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130409 |
| Hersteller Artikelnummer: |
orb2130409 |
| Alternativnummer: |
BYT-ORB2130409-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human EBF4 |
| Konjugation: |
FITC |
| Alternative Synonym: |
Ebf3, O/E-, O/E-4, Olf-1 |
| EBF4 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
60kDa |
| NCBI: |
694538 |
| UniProt: |
Q8K4J2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: YDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNGLRTEQ |
