OBOX6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130419
Artikelname: OBOX6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130419
Hersteller Artikelnummer: orb2130419
Alternativnummer: BYT-ORB2130419-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse OBOX6
Konjugation: Biotin
Alternative Synonym: D17Ertd599, D17Ertd599e
OBOX6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 663756
UniProt: Q8VHG3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES