Onecut3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130428
Artikelname: Onecut3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130428
Hersteller Artikelnummer: orb2130428
Alternativnummer: BYT-ORB2130428-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse Onecut3
Konjugation: Biotin
Alternative Synonym: Oc, OC-, Oc3, OC-3
Onecut3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 631972
UniProt: Q8K557
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QATISQQLGLELNTVSNFFMNARRRCMNRWAEEPGATPGTGTATATFSKA