Sp7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130482
Artikelname: Sp7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130482
Hersteller Artikelnummer: orb2130482
Alternativnummer: BYT-ORB2130482-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Sp7
Konjugation: Biotin
Alternative Synonym: Osx
Sp7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 001032721
UniProt: Q6IMK1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST