Fbxw7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130488
| Artikelname: |
Fbxw7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130488 |
| Hersteller Artikelnummer: |
orb2130488 |
| Alternativnummer: |
BYT-ORB2130488-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Fbxw7 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
A, AGO, Cdc4, Fbw7, SEL-, Fbwd6, Fbx30, Fbxo3, Fbxw6, Fbxo30, SEL-10, 1110001A17Rik |
| Fbxw7 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
70kDa |
| NCBI: |
536353 |
| UniProt: |
Q8VBV4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG |
