Taf7l Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130545
Artikelname: Taf7l Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130545
Hersteller Artikelnummer: orb2130545
Alternativnummer: BYT-ORB2130545-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Taf7l
Konjugation: Biotin
Alternative Synonym: Taf2, Taf2q, 4933438I11Rik
Taf7l Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 083234
UniProt: Q9D3R9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ