RNF6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130548
| Artikelname: |
RNF6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130548 |
| Hersteller Artikelnummer: |
orb2130548 |
| Alternativnummer: |
BYT-ORB2130548-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RNF6 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
AA537053, 1200013I08Rik, 5730419H05Rik |
| RNF6 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
73kDa |
| NCBI: |
083050 |
| UniProt: |
Q9DBU5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM |
