TTC19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130557
Artikelname: TTC19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130557
Hersteller Artikelnummer: orb2130557
Alternativnummer: BYT-ORB2130557-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse TTC19
Konjugation: Biotin
Alternative Synonym: AI505442, 2010204O13Rik, 2810460C24Rik
TTC19 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 082636
UniProt: Q5NCZ4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ