Dmrtc2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130572
Artikelname: Dmrtc2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130572
Hersteller Artikelnummer: orb2130572
Alternativnummer: BYT-ORB2130572-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dmrtc2
Konjugation: Biotin
Alternative Synonym: Dmrt, Dmrt7, 4933432E21Rik
Dmrtc2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 082008
UniProt: Q8CGW9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHP