Hsfy2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130578
Artikelname: Hsfy2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130578
Hersteller Artikelnummer: orb2130578
Alternativnummer: BYT-ORB2130578-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hsfy2
Konjugation: Biotin
Alternative Synonym: Hspy2l, 4933413G11Rik
Hsfy2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 081937
UniProt: Q80Y37
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSDFSLATP