ISL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130581
Artikelname: ISL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130581
Hersteller Artikelnummer: orb2130581
Alternativnummer: BYT-ORB2130581-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL2
Konjugation: Biotin
Alternative Synonym: isle, 3110001N10Rik
ISL2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 081673
UniProt: Q9CXV0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH