Aste1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130617
Artikelname: Aste1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130617
Hersteller Artikelnummer: orb2130617
Alternativnummer: BYT-ORB2130617-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aste1
Konjugation: Biotin
Alternative Synonym: AV006403, 1100001A21Rik
Aste1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 079927
UniProt: Q8BIR2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLM