NRIP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130662
Artikelname: NRIP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130662
Hersteller Artikelnummer: orb2130662
Alternativnummer: BYT-ORB2130662-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse NRIP2
Konjugation: Biotin
Alternative Synonym: NI, NIX1, AW491344
NRIP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 068363
UniProt: Q14BZ2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG