Ascl3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130680
Artikelname: Ascl3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130680
Hersteller Artikelnummer: orb2130680
Alternativnummer: BYT-ORB2130680-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Ascl3
Konjugation: Biotin
Alternative Synonym: Sg, Sgn1, bHLHa, bHLHa42
Ascl3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 064435
UniProt: Q9JJR7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR