Atf7ip Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130728
| Artikelname: |
Atf7ip Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130728 |
| Hersteller Artikelnummer: |
orb2130728 |
| Alternativnummer: |
BYT-ORB2130728-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Mouse Atf7ip |
| Konjugation: |
Biotin |
| Alternative Synonym: |
A, AM, Mcaf, Mcaf1, 2610204M12Rik, 5830415B17Rik |
| Atf7ip Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
138kDa |
| NCBI: |
062299 |
| UniProt: |
Q7TT18 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVESK |
