TEF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130740
Artikelname: TEF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130740
Hersteller Artikelnummer: orb2130740
Alternativnummer: BYT-ORB2130740-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse TEF
Konjugation: Biotin
Alternative Synonym: 2310028D20Rik
TEF Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 059072
UniProt: Q9JLC6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL