MYBBP1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130755
| Artikelname: |
MYBBP1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130755 |
| Hersteller Artikelnummer: |
orb2130755 |
| Alternativnummer: |
BYT-ORB2130755-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse MYBBP1A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902 |
| MYBBP1A Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
148kDa |
| NCBI: |
058056 |
| UniProt: |
Q7TPV4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP |
